ScamLens는 90개 이상의 위협 인텔리전스 소스를 사용하여 snowagainfearfreezesagainagainitfeelslikeiceisinmyhands.space을 분석하고 신뢰 점수 72/100을 부여했으며, 안전로 분류했습니다.
신뢰 점수: 72/100
위험 수준: 높음
현재 가장 강한 위험 신호는 없지만, 그렇다고 사건이 자동으로 클리어되지는 않습니다. 실제 거래 시나리오, 회사 신원, 통신 방법을 확인하여 계속하세요.
빠른 답변
현재 가장 강한 위험 신호는 없지만, 그렇다고 사건이 자동으로 클리어되지는 않습니다. 실제 거래 시나리오, 회사 신원, 통신 방법을 확인하여 계속하세요.
긍정적 신호
- +Google Safe Browsing: 안전
- +HTTPS 암호화 지원
발견된 우려 사항 없음
점수 분석
이 평가가 정확했습니까?
snowagainfearfreezesagainagainitfeelslikeiceisinmyhands.space 은(는) 합법적으로 보입니다
이 도메인을 위협 피드가 표시하지 않았습니다. 기본 온라인 안전 습관을 유지하세요.
- 공식 URL을 즐겨찾기에 추가하세요사기범은 유사 도메인으로 정품 브랜드를 자주 위조합니다. 즐겨찾기는 오타로 인한 함정을 방지합니다.
- 예상치 못한 결제 요청에 주의정품 사이트도 해킹될 수 있습니다. 갑작스러운 '긴급 결제' 알림은 의심하세요.
- HTTPS와 정확한 철자 확인주소창 자물쇠 아이콘을 확인하고 비밀번호나 카드 정보를 입력하기 전에 도메인을 한 글자씩 검증하세요.
Sign in to run the AI risk analysis
The threat-intelligence signals below are available to everyone. The plain-language AI risk summary is generated on demand for signed-in users — sign in (free) to run it for this domain.
위협 인텔리전스 소스
22개 소스 조회 — 1개가 이 도메인을 표시함
소스 세부 정보 표시
위협 인텔리전스 소스
22개 소스 조회 — 1개가 이 도메인을 표시함
- safe_browsing정상
- urlhaus정상
- cloudflare_radar정상
- cert_transparency정상
- alienvault_otx정상
- phishstats정상
- phishdestroy정상
- threatfox정상
- shodan_internetdb정상
- phishtank정상
- rdap정상
- maltiverse정상
- dns_security정상
- wanted_domains정상
- darkweb정상
- maltrail표시됨
- openphish정상
- scam_blocklist정상
- crypto_scam_feed정상
- phishing_army정상
- hagezi_tif정상
- red_flag_domains정상
ScamLens는 Google Safe Browsing, VirusTotal, PhishTank, URLhaus, ThreatFox, Cloudflare Radar, OTX, IPQS, GoPlus, Honeypot.is 등 30개 이상의 상용 및 오픈소스 위협 인텔리전스 소스의 신호를 실시간으로 집계합니다. 표시 사실은 증거이지만, 표시가 없다는 것이 안전을 증명하지는 않습니다. 아래 신호와 커뮤니티 신고를 함께 검토하여 판단하십시오.
Advanced Scan
Comprehensive data lookup across premium sources
- Website history verification
- Detailed WHOIS information
- Reverse WHOIS association
- Traffic rank analysis
- Company registration check
AI Deep Investigation
Cross-check the story, claims, and supporting evidence before you decide
- Everything in Advanced Scan
- AI website content analysis
- AI cross-reference verification
- Claim authenticity validation
- Detailed report with evidence
Comprehensive Investigation
Full-spectrum investigation with company deep search & social intelligence
- Everything in Deep Investigation
- AI company background search
- Social media intelligence
- Detailed suspicious point analysis
- Event timeline & entity connections
This analysis is for informational purposes only and does not constitute a legal determination.
보안 소스
도메인 정보
- DNSSEC
- 비활성화
SSL/TLS 인증서
데이터 없음
서버 정보
데이터 없음
관련 인텔리전스
기술 세부 정보 (DNS / 헤더 / 서브도메인)
DNS 레코드
데이터 없음
HTTP 보안 헤더
채널 / 서브도메인
데이터 없음
커뮤니티 보고서
신고 및 경험 공유를 위해 로그인하세요
주의해서 진행
아직 가장 강한 위험 신호는 없지만, 도메인만으로는 사건을 클리어하기에 충분하지 않습니다
사건이 여전히 쇼핑, 투자, 회수, 또는 브랜드 지원 주장을 포함한다면, 시나리오 기반 검토가 결과를 단순히 새로 고침하는 것보다 더 가치 있습니다.
본 결과는 여러 타사 데이터 소스와 AI 모델을 기반으로 합니다. 오탐 또는 미탐이 발생할 수 있습니다. 이 보고서를 어떤 결정의 유일한 근거로 사용해서는 안 됩니다. 추가 소스를 통해 확인해 주세요.
실제 시나리오 확인을 계속 진행하세요
쇼핑몰, 투자 플랫폼 또는 복구 서비스인 경우 도메인 검사만으로 판단하지 마세요
이미 결제, 로그인 또는 파일을 다운로드했다면 즉시 행동 계획으로 이동하세요
관련 보안 가이드
이러한 유형의 위협으로부터 자신을 보호하는 방법에 대해 자세히 알아보세요.
이 위협 이해하기
자주 묻는 질문
Is snowagainfearfreezesagainagainitfeelslikeiceisinmyhands.space safe to visit?
snowagainfearfreezesagainagainitfeelslikeiceisinmyhands.space received a trust score of 72/100 from ScamLens, based on analysis of 30+ threat intelligence sources. No significant threats were detected. The site appears safe and trustworthy.
Was snowagainfearfreezesagainagainitfeelslikeiceisinmyhands.space flagged by any threat databases?
snowagainfearfreezesagainagainitfeelslikeiceisinmyhands.space was flagged by 1 out of 30+ threat intelligence sources. Specifically flagged by: maltrail. The detected threat categories include: general threat.
How old is snowagainfearfreezesagainagainitfeelslikeiceisinmyhands.space?
Registration date information for snowagainfearfreezesagainagainitfeelslikeiceisinmyhands.space is not publicly available through WHOIS records, which can itself be a risk indicator.
Does snowagainfearfreezesagainagainitfeelslikeiceisinmyhands.space use HTTPS and have a valid SSL certificate?
ScamLens could not verify the SSL certificate details for snowagainfearfreezesagainagainitfeelslikeiceisinmyhands.space during this scan. Treat this as unavailable evidence, not as proof that the site is safe or unsafe.
What security headers does snowagainfearfreezesagainagainitfeelslikeiceisinmyhands.space implement?
No security header information was available for snowagainfearfreezesagainagainitfeelslikeiceisinmyhands.space.
What does the ScamLens community think about snowagainfearfreezesagainagainitfeelslikeiceisinmyhands.space?
No community votes or reports have been submitted for snowagainfearfreezesagainagainitfeelslikeiceisinmyhands.space yet. You can be the first to share your experience.
What should I do about snowagainfearfreezesagainagainitfeelslikeiceisinmyhands.space?
Based on our analysis, snowagainfearfreezesagainagainitfeelslikeiceisinmyhands.space appears safe. You can proceed with normal caution. Always verify URLs manually and avoid clicking suspicious links.
이 보고서가 도움이 되셨나요?
이 보고서를 사용하여 다른 사람들에게 완전한 클리어런스로 취급하기보다 쇼핑, 투자, 또는 지원 시나리오를 검증하라고 상기시키세요.
부모님에게 전달해 주세요 — 안전한 인터넷 사용은 모두의 권리입니다.
이 분석에 대해
이 보고서는 90개 이상의 위협 인텔리전스 소스의 실시간 데이터와 AI 분석 및 커뮤니티 피드백을 결합하여 생성됩니다.
점수 산정 방법론 알아보기 | 마지막 분석: 2026년 8월 4일