ScamLens
Cached < 6hAnonymous (3/day)

Security Report for ivvvaaannaaalaaawiiiiifamilly.blogspot.com

ScamLens analyzed ivvvaaannaaalaaawiiiiifamilly.blogspot.com using 90+ threat intelligence sources and assigned a trust score of 25/100, classifying it as high risk.

Trust Score: 25/100

Risk Level: High Risk

This domain already shows strong risk signals. Stop interacting, preserve the page, chat, phone, and payment evidence, and move into response or reporting immediately.

Site Title
Ivana Alawi Espesyal sa Facebook
Website meta information unavailable
HTTPS ✓
1
Checked 1 times

Quick Answer

This domain already shows strong risk signals. Stop interacting, preserve the page, chat, phone, and payment evidence, and move into response or reporting immediately.

Positive Signals

  • +Google Safe Browsing: Safe
  • +HTTPS encryption supported

Concerns

  • -3 security sources flagged as suspicious

Score Breakdown

Domain Reputation50
Threat Intelligence91
13/16 safeSafeBrowsing OK
Technical Security60
HTTPS
Community Reputation50
No community data yet

Was this assessment accurate?

0 say Safe0 say Suspicious
What do you think?
What to do next

ivvvaaannaaalaaawiiiiifamilly.blogspot.com looks like a phishing site

At least one trusted threat-intelligence feed flagged this domain. Treat any credential prompt as hostile.

Confidence:High
  1. Do not enter passwords or card details
    Phishing pages clone legitimate brand UIs to steal credentials. If you already entered them, change those passwords immediately on the real site.
  2. Close the tab and clear browser data for this domain
    This breaks any session cookie the page set and reduces the risk of follow-up phishing prompts.
  3. Report it so others are protected
    One community report can warn thousands of visitors. Use the button below.
Cross-check with independent scanners

Trust but verify — open this domain on unrelated security services and compare the verdict.

Sign in to run the AI risk analysis

The threat-intelligence signals below are available to everyone. The plain-language AI risk summary is generated on demand for signed-in users — sign in (free) to run it for this domain.

Threat-intelligence sources

Checked across 22 sources — 3 flagged this domain

Show source breakdown
  • safe_browsingclean
  • urlhausclean
  • cloudflare_radarclean
  • cert_transparencyclean
  • alienvault_otxclean
  • phishstatsclean
  • phishdestroyflagged
  • threatfoxclean
  • shodan_internetdbclean
  • phishtankclean
  • rdapclean
  • maltiverseclean
  • dns_securityflagged
  • wanted_domainsclean
  • darkwebclean
  • openphishflagged
  • scam_blocklistclean
  • maltrailclean
  • crypto_scam_feedclean
  • phishing_armyclean
  • hagezi_tifclean
  • red_flag_domainsclean

ScamLens aggregates real-time signals from 90+ commercial and open-source threat-intelligence providers including Google Safe Browsing, VirusTotal, PhishTank, URLhaus, ThreatFox, Cloudflare Radar, OTX, IPQS, GoPlus, Honeypot.is, and more. A flagged signal is evidence; the absence of flags is not proof of safety. Use the signals below alongside community reports to decide.

Advanced Scan

Comprehensive data lookup across premium sources

$2.99one-time payment
  • Website history verification
  • Detailed WHOIS information
  • Reverse WHOIS association
  • Traffic rank analysis
  • Company registration check
Recommended

AI Deep Investigation

Cross-check the story, claims, and supporting evidence before you decide

$4.99one-time payment
  • Everything in Advanced Scan
  • AI website content analysis
  • AI cross-reference verification
  • Claim authenticity validation
  • Detailed report with evidence
Most Thorough

Comprehensive Investigation

Full-spectrum investigation with company deep search & social intelligence

$14.99one-time payment
  • Everything in Deep Investigation
  • AI company background search
  • Social media intelligence
  • Detailed suspicious point analysis
  • Event timeline & entity connections

This analysis is for informational purposes only and does not constitute a legal determination.

Security Sources

Google Safe Browsing
Safe
Cloudflare Radar
Safe
URLhaus (abuse.ch)Confidence: Medium
Not Listed
Certificate TransparencyConfidence: Low
Not Listed
AlienVault OTXConfidence: Low
Not Listed
PhishStatsConfidence: Low
Not Listed
PhishDestroyConfidence: High
Unsafe
ThreatFox (abuse.ch)Confidence: Low
Not Listed
Shodan InternetDBConfidence: Medium
Not Listed
PhishTankConfidence: Low
Not Listed
RDAP Domain RegistrationConfidence: Low
Not Listed
MaltiverseConfidence: Low
Not Listed
DNS SecurityConfidence: High
Unsafe
Law EnforcementConfidence: Low
Not Listed
darkwebConfidence: Low
Not Listed
OpenPhishConfidence: Medium
Unsafe
Scam Blocklist (Jarelllama)Confidence: Low
Not Listed
Maltrail (stamparm)Confidence: Low
Not Listed
Crypto Scam FeedConfidence: Low
Not Listed
Phishing ArmyConfidence: Low
Not Listed
HaGeZi Threat IntelligenceConfidence: Low
Not Listed
Red Flag DomainsConfidence: Low
Not Listed

Domain Information

DNSSEC
Disabled

SSL/TLS Certificate

No data available

Server Information

IP Address
142.250.9.132
Hosting Provider
Google LLC
ASN
AS15169 Google LLC
Server Location
Mountain View, United States
Organization
Google LLC

Related Intelligence

Technical Details (DNS / Headers / Subdomains)

DNS Records

Email Security

SPF Not ConfiguredDMARC Not Configured
TypeValue
A142.250.9.132
AAAA2607:f8b0:4002:c2c::84
CNAMEblogspot.l.googleusercontent.com

HTTP Security Headers

1/6
Strict-Transport-SecurityMissing
Content-Security-PolicyMissing
X-Frame-OptionsMissing
X-Content-Type-OptionsPresent

nosniff

Referrer-PolicyMissing
Permissions-PolicyMissing

Channels / Subdomains

No data available

Community Reports

Log in to report and share your experience

...

Report & Take Down This Website

The results are based on multiple third-party data sources and AI models. False positives or negatives may occur. This report should not be used as the sole basis for any decision. Please verify with additional sources.

If a loss already happened, move into the response flow now

Delay is the main risk with high-risk domains. Prioritize freezes, credential resets, reporting, and evidence preservation now.

Start the response

If no loss happened yet, continue with the website-reporting and official-agency paths next.

Related Security Guides

Learn more about how to protect yourself from this type of threat.

Understanding this threat

FAQ

Is ivvvaaannaaalaaawiiiiifamilly.blogspot.com safe to visit?

ivvvaaannaaalaaawiiiiifamilly.blogspot.com received a trust score of 25/100 from ScamLens, indicating several security concerns. 3 threat intelligence sources flagged this domain. Proceed with extreme caution.

Was ivvvaaannaaalaaawiiiiifamilly.blogspot.com flagged by any threat databases?

ivvvaaannaaalaaawiiiiifamilly.blogspot.com was flagged by 3 out of 30+ threat intelligence sources. Specifically flagged by: phishdestroy, dns_security, openphish. The detected threat categories include: general threat.

How old is ivvvaaannaaalaaawiiiiifamilly.blogspot.com?

Registration date information for ivvvaaannaaalaaawiiiiifamilly.blogspot.com is not publicly available through WHOIS records, which can itself be a risk indicator.

Does ivvvaaannaaalaaawiiiiifamilly.blogspot.com use HTTPS and have a valid SSL certificate?

ScamLens could not verify the SSL certificate details for ivvvaaannaaalaaawiiiiifamilly.blogspot.com during this scan. Treat this as unavailable evidence, not as proof that the site is safe or unsafe.

What security headers does ivvvaaannaaalaaawiiiiifamilly.blogspot.com implement?

ivvvaaannaaalaaawiiiiifamilly.blogspot.com is missing important security headers: Content-Security-Policy, X-Frame-Options, X-Content-Type-Options, Strict-Transport-Security, Referrer-Policy, Permissions-Policy. Missing security headers can leave visitors vulnerable to cross-site scripting (XSS) and other web-based attacks.

What does the ScamLens community think about ivvvaaannaaalaaawiiiiifamilly.blogspot.com?

No community votes or reports have been submitted for ivvvaaannaaalaaawiiiiifamilly.blogspot.com yet. You can be the first to share your experience.

Where is ivvvaaannaaalaaawiiiiifamilly.blogspot.com hosted?

ivvvaaannaaalaaawiiiiifamilly.blogspot.com is hosted by Google LLC in Mountain View, United States (ASN: ASAS15169 Google LLC).

Is this report useful?

Use this report to tell others to stop interacting now and move straight into containment, evidence preservation, and reporting.

Forward to your parents — they deserve to browse safely too.

About this analysis

This report is generated from real-time data across 90+ threat intelligence sources, combined with AI analysis and community feedback.

Learn about our scoring methodology | Last analyzed: July 30, 2026

All Google LLC domains